PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV33934.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 202aa    MW: 22141.4 Da    PI: 6.7936
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV33934.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox50.82.8e-162787257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  KZV33934.1 27 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKMLekfgSVGDANVFYWFQNRRSRSRR 87
                89*****************99*************************************997 PP

2Wus_type_Homeobox109.32.3e-352689265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RWtP+peQi iLe++++sG+++P+k+e+ ri+++Le++G ++d+NVfyWFQNr++R+r++q
         KZV33934.1 26 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKMLEKFGSVGDANVFYWFQNRRSRSRRRQ 89
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.5482388IPR001356Homeobox domain
SuperFamilySSF466894.71E-142494IPR009057Homeodomain-like
SMARTSM003891.5E-62592IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-92692IPR009057Homeodomain-like
PfamPF000465.8E-142787IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGDQGQESGG SRPSYGGEAE QRNEPVRSRW TPKPEQILIL ESIFNSGMVN PPKDETVRIR  60
KMLEKFGSVG DANVFYWFQN RRSRSRRRQR QIQASLTAVE LPQAPPHGGG GAIQFDQINA  120
AGFMPGSSLS FSANSSSSSC LMGSGTSSSS GITENTCIPH NSHDFYSFSG LQELDHNPIF  180
SHSDASSLHY PPGELSFFFL FS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069976.15e-61PREDICTED: WUSCHEL-related homeobox 11-like
TrEMBLA0A068VCF03e-45A0A068VCF0_COFCA; Uncharacterized protein
STRINGPOPTR_0013s06310.14e-40(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.21e-34WUSCHEL related homeobox 12